PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn028271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 294aa    MW: 32384.3 Da    PI: 6.9466
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn028271genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13.1e-4371061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp +qp+kf nvhk+FGasnv k+l++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q +++l  +k+
  Achn028271   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFSNVHKVFGASNVAKILNELNAAQREDAVNSLAYEAEARLRDPVYGCVGLISILQHKLKQIQVDLYNAKK 105
                 7********************************************************************************************999887 PP

      DUF260 100 e 100
                 e
  Achn028271 106 E 106
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8616107IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFSNVH KVFGASNVAK ILNELNAAQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HKLKQIQVDL YNAKKELATY IGPSAMLPIL  120
QHPGFIGNNP SSSSAIPYNM SPMLGLPSGT PHNAQLVIRE SQQPHHHHQQ MLEAHQLAAV  180
VAAREQQEML RTYEQQQQEL VRFNSGFDQG GPMGASGFNQ MSRGAALSPS LALGSFDEGP  240
YQIQQQPQEH SHPHELQLQS QLLLQQQQPE QPQTPQQQQR SGNEDGRSVG PSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774046.11e-124PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016502483.11e-124PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-88LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-122A0A0B0PS92_G
STRINGVIT_07s0197g00020.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-89ASYMMETRIC LEAVES 2-like 1